{ }, { "context" : "lia-deleted-state", "action" : "rerender" LITHIUM.Auth.CHECK_SESSION_TOKEN = 'QaW0wN5I0cgzAvMepwS5ZCmnXBrYOeatvAyn0PZjErI. { "context" : "envParam:quiltName,product,contextId,contextUrl", { "useTruncatedSubject" : "true", }, "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetAnswerForm", }, "activecastFullscreen" : false, ] "forceSearchRequestParameterForBlurbBuilder" : "false", ] { "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] } "actions" : [ } else { } var count = 0; LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:quiltName,message", } { "truncateBody" : "true", element.siblings('li').removeClass('active'); { "action" : "rerender" "action" : "pulsate" }, { //$('#lia-body').addClass('lia-window-scroll'); "}); { var key = e.keyCode; }, "context" : "envParam:quiltName,product,contextId,contextUrl", $(this).removeAttr('href'); .attr('aria-selected','false'); "action" : "rerender" "action" : "pulsate" Make a written complain, over their complaint form one a day should do it. } ] ] return; "action" : "rerender" "}); ] }, }, }); var keycodes = { "event" : "editProductMessage", } { } } "actions" : [ "event" : "AcceptSolutionAction", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2194560,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ Online-Spiele sind oft eine große Her­aus­forderung. $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "useSubjectIcons" : "true", "context" : "envParam:entity", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", { "useTruncatedSubject" : "true", "action" : "rerender" The modem\router might be synced on 10 000 Mb it won't matter if real speeds you are getting are 4Mb which is a pain to stream anything for one pc at home . LITHIUM.AjaxSupport.ComponentEvents.set({ ] { "action" : "rerender" ] } } }, { "actions" : [ "action" : "rerender" "actions" : [ Nun habe ich die Vodafone Station und bin etwas irritiert. { { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2194560 .lia-rating-control-passive', '#form_0'); "event" : "approveMessage", }, element.find('ul').slideUp(); To find out where to enter these settings, check the instructions below (or refer to any instructions that came with your modem): ... (SIM card) solution to connect to the monitoring station. } "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetCommentForm", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. if (element.hasClass('active')) { "useSubjectIcons" : "true", { } // Reset the conditions so that someone can do it all again. element.find('ul').slideUp(); ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pmfUI7ePt0Uh4CagVJbWbOdmvF4ZnVZg_NvW1oLcVic. } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2197073,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "selector" : "#kudosButtonV2", "action" : "pulsate" "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "actions" : [ } } "disallowZeroCount" : "false", }, } { } //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} "revokeMode" : "true", ] ] resetMenu(); ] "truncateBody" : "true", "event" : "approveMessage", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2197073 .lia-rating-control-passive', '#form_2'); ] "event" : "ProductMessageEdit", { } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", var count = 0; LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "action" : "rerender" $('#vodafone-community-header').toggle(); } "actions" : [ { $(document).ready(function(){ } $('#node-menu li.active').children('ul').show(); { "actions" : [ "context" : "envParam:selectedMessage", "truncateBodyRetainsHtml" : "false", "entity" : "2194592", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { { }, LITHIUM.AjaxSupport.ComponentEvents.set({ "showCountOnly" : "false", }, if ( watching ) { "event" : "QuickReply", ], "context" : "", Öffne dafür die „Ein­stel­lun­gen“ und wäh­le dann „Net­zw­erk“ aus. "actions" : [ }, }, return; /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } 2.1 Connecting your Vodafone Station to the fi xed network As per the Set-up Wizard step on your LCD screen, please connect your computer to the Vodafone Station using the white cable with yellow tags provided. ctaHTML += "Lösung noch nicht gefunden? "event" : "RevokeSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ { "initiatorBinding" : true, Upload ist kaum vorhanden (Lag gestern Abend bei 0,2 Mbits/s). "actions" : [ $(this).addClass('active') } } { } } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); $(this).addClass('active') LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, event.preventDefault(); { "eventActions" : [ "context" : "lia-deleted-state", } "initiatorDataMatcher" : "data-lia-kudos-id" var key = e.keyCode; LITHIUM.AjaxSupport.useTickets = false; LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"JnfL0Odxc81nG8dRz7r2084pmfF-MfvUYG91nuw9DfU. "displaySubject" : "true", } "context" : "", //$('#lia-body').removeClass('lia-window-scroll'); "event" : "MessagesWidgetAnswerForm", $(document).ready(function(){ "event" : "removeThreadUserEmailSubscription", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }); { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "unapproveMessage", ] { "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "action" : "rerender" Vodafone Station. { "actions" : [ Vodafone was the first company in Europe to introduce Multiple Antenna (Massive MIMO) and we have installed 100-gigabit-per-second capable optical fibre connections to our 5G base stations. { "eventActions" : [ }, "context" : "", "messageViewOptions" : "1111110111111111111110111110100101011101" ] element.siblings('li').find('ul').slideUp(); } "event" : "removeMessageUserEmailSubscription", "event" : "removeMessageUserEmailSubscription", "context" : "", } "context" : "", $('.js-close-header-announcement').on('click', clickHandler); LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_65addd5a1896b","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "action" : "pulsate" { "event" : "addMessageUserEmailSubscription", } }, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_65addd5a1896b_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "actions" : [ "actions" : [ "action" : "rerender" ] "actions" : [ } } "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:quiltName", "event" : "addThreadUserEmailSubscription", }, "event" : "MessagesWidgetEditAction", var resetMenu = function() { Sobald Vodafone die neue Firmware-Version 2.017 für die Vodafone Station für die Breite freigegeben hat, sollte das Update automatisch auf den Geräten installiert werden. { } "message" : "2194560", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":690,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAABlZTBF0FBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVVUwRWBVBTAhRUVwcASQFSAQBIV1UKCk8EU1NUUgwLBwRUDwJAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}. ] } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } { }, "revokeMode" : "true", // console.log(key); "forceSearchRequestParameterForBlurbBuilder" : "false", { }); // Oops. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "activecastFullscreen" : false, "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "event" : "MessagesWidgetCommentForm", "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_65addd5a1896b","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, "actions" : [ "action" : "rerender" "}); "event" : "deleteMessage", lithadmin: [] "disableKudosForAnonUser" : "false", { "actions" : [ "displayStyle" : "horizontal", "event" : "ProductAnswer", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", ] "showCountOnly" : "false", ] "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pmfUI7ePt0Uh4CagVJbWbOdmvF4ZnVZg_NvW1oLcVic. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); Allow it to select a network automatically Allow your phone to select a network automatically. { ] ] //var height = $(window).scrollTop(); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "includeRepliesModerationState" : "false", "event" : "markAsSpamWithoutRedirect", $('#vodafone-community-header .lia-search-toggle').click(function() { { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); }, { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "useTruncatedSubject" : "true", "event" : "editProductMessage", "context" : "envParam:feedbackData", "actions" : [ ;(function($) { "componentId" : "forums.widget.message-view", "}); { ] if ( count == neededkeys.length ) { "event" : "AcceptSolutionAction", "event" : "ProductAnswerComment", "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:quiltName", { "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "context" : "", "}); // Set start to true only if the first key in the sequence is pressed "}); }); { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"JnfL0Odxc81nG8dRz7r2084pmfF-MfvUYG91nuw9DfU. "event" : "ProductAnswerComment", ] } "context" : "", { { "kudosable" : "true", "event" : "kudoEntity", } } { ] }, }, "event" : "ProductAnswer", "event" : "MessagesWidgetAnswerForm", })(LITHIUM.jQuery); "}); }, LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2193907}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2194560}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2194592}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2197073}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492762}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492188}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493135}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2494410}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493193}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543691}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543652}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543574}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543553}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543537}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543527}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543517}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543439}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543417}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543397}}]); "triggerEvent" : "click", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2197073,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" "context" : "envParam:quiltName", "event" : "ProductAnswerComment", { "event" : "ProductMessageEdit", { "actions" : [ ] { "event" : "editProductMessage", } "disableLabelLinks" : "false", "disallowZeroCount" : "false", { count = 0; { { "actions" : [ { "actions" : [ { }, ] LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); } "actions" : [ }, LITHIUM.Dialog({ "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" })(LITHIUM.jQuery); "message" : "2194592", { }); } "}); ] "forceSearchRequestParameterForBlurbBuilder" : "false", watching = false; } ] }, { { "action" : "rerender" "context" : "", ] }, "action" : "rerender" } else { "action" : "rerender" var key = e.keyCode; LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65addd6dd0e89', 'disableAutoComplete', '#ajaxfeedback_65addd5a1896b_0', 'LITHIUM:ajaxError', {}, 'j5BMlddR9oW_cngobv2vc-qOdMS8PaGJJyWbW8csSZk. "actions" : [ "parameters" : { ] $(this).next().toggle(); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); })(LITHIUM.jQuery); // Pull in global jQuery reference LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { ;(function($) { "actions" : [ { if ( watching ) { "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" Zusätzlich startet mein Router, aus einem mir unersichtlichen Grund, täglich min. "context" : "envParam:quiltName,product,contextId,contextUrl", "eventActions" : [ ] { lithstudio: [], "actions" : [ "context" : "envParam:entity", "action" : "rerender" "actions" : [ { "selector" : "#messageview_2", "actions" : [ ', 'ajax'); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'QaW0wN5I0cgzAvMepwS5ZCmnXBrYOeatvAyn0PZjErI. "action" : "rerender" ] "useTruncatedSubject" : "true", "initiatorDataMatcher" : "data-lia-message-uid" { "action" : "rerender" }, { "truncateBodyRetainsHtml" : "false", ] "useTruncatedSubject" : "true", { "action" : "rerender" "event" : "QuickReply", "action" : "rerender" "displaySubject" : "true", { window.location.replace('/t5/user/userloginpage'); }, } } "event" : "QuickReply", ;(function($){ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ .attr('aria-selected','true'); ] "action" : "rerender" "action" : "pulsate" Nun gehst Du auf „Inter­netverbindung testen“ und wartest, bis Deine Kon­sole alle Prü­fun­gen abgeschlossen hat. element.addClass('active'); "context" : "envParam:quiltName", } "eventActions" : [ } "event" : "markAsSpamWithoutRedirect", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ] //resetMenu(); ', 'ajax'); { }, These are the basis for getting out of contract with them if they say otherwise that you have to stay, complain! { // Register the click event handler "actions" : [ "disableLabelLinks" : "false", window.onload = function() { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2194592 .lia-rating-control-passive', '#form_1'); LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); if ( !watching ) { "context" : "envParam:quiltName", "closeEvent" : "LITHIUM:lightboxCloseEvent", $(document).ready(function(){ "action" : "rerender" { } { ] "actions" : [ "action" : "pulsate" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "useSubjectIcons" : "true", "selector" : "#kudosButtonV2_1", "actions" : [ } "actions" : [ } Beson­ders bei Shootern und Sport­spie­len zählt jede Mil­lisekunde. "context" : "envParam:quiltName", })(LITHIUM.jQuery); "linkDisabled" : "false" "action" : "rerender" window.scrollTo(0,position_x.top - 150); "actions" : [ }, "actions" : [ { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":690,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAABlZTBF0FBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVVUwRWBVBTAhRUVwcASQFSAQBIV1UKCk8EU1NUUgwLBwRUDwJAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};

Yoko Sushi Speisekarte Bergedorf, Frauenarzt Online Termin Wien, Efi Network 0 For Ipv4 Boot Failed Medion, Kaufhaus Sauer Bad Hersfeld öffnungszeiten, Enge Jeans Shorts Damen, Organisation Der Uno Abk, Onkologie Wels ärzte, Erzgebirge Mit Kindern, Pop-up Bar Wikipedia, Javascript Integer Bit Shift,